Lineage for d2o8ab1 (2o8a B:6-299)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440476Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1440477Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1440548Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 1440574Protein Protein phosphatase-1 (PP-1) [56311] (5 species)
  7. 1440596Species Norway rat (Rattus norvegicus) [TaxId:10116] [160869] (2 PDB entries)
  8. 1440600Domain d2o8ab1: 2o8a B:6-299 [148673]
    automatically matched to d1jk7a_

Details for d2o8ab1

PDB Entry: 2o8a (more details), 2.61 Å

PDB Description: rat pp1cgamma complexed with mouse inhibitor-2
PDB Compounds: (B:) Serine/threonine-protein phosphatase PP1-gamma catalytic subunit

SCOPe Domain Sequences for d2o8ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o8ab1 d.159.1.3 (B:6-299) Protein phosphatase-1 (PP-1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
klnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdi
hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh
ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
irrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlic
rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

SCOPe Domain Coordinates for d2o8ab1:

Click to download the PDB-style file with coordinates for d2o8ab1.
(The format of our PDB-style files is described here.)

Timeline for d2o8ab1: