SCOPe 2.07: Domain d2o61b1: 2o61 B:251-350

Lineage for d2o61b1 (2o61 B:251-350)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49249] (3 PDB entries)
   Uniprot P25799 245-350

8. Domain d2o61b1: 2o61 B:251-350 [148620]
   Other proteins in same PDB: d2o61b2
   automated match to d1ooaa1
   protein/DNA complex

Details for d2o61b1

PDB Entry: 2o61, 2.8 Å

PDB Description: crystal structure of nfkb, irf7, irf3 bound to the interferon-b enhancer

PDB Compounds: (B:) Nuclear factor NF-kappa-B p105 subunit

SCOPe Domain Sequences for d2o61b1:

Sequence; same for both SEQRES and ATOM records:

>d2o61b1 b.1.18.1 (B:251-350) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens) [TaxId: 9606]}
vrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrqfaiv
fktpkykdinitkpasvfvqlrrksdletsepkpflyype

Timeline for d2o61b1:

• d2o61b1 first appeared in SCOP 1.75
  
• d2o61b1 appears in SCOPe 2.06
  
• d2o61b1 appears in the current release, SCOPe 2.08