SCOPe 2.07: Domain d2jy7a2: 2jy7 A:3-52

Lineage for d2jy7a2 (2jy7 A:3-52)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (5 families)

5. Family a.5.2.1: UBA domain [46935] (25 proteins)

6. Protein Sequestosome 1 (Sqstm1) [101063] (1 species)
   ubiquitin-binding protein p62

7. Species Human (Homo sapiens) [TaxId:9606] [101064] (5 PDB entries)

8. Domain d2jy7a2: 2jy7 A:3-52 [148239]
   Other proteins in same PDB: d2jy7a3
   automated match to d2k0bx1

Details for d2jy7a2

PDB Entry: 2jy7

PDB Description: nmr structure of the ubiquitin associated (uba) domain of p62 (sqstm1). rdc refined

PDB Compounds: (A:) Ubiquitin-binding protein p62

SCOPe Domain Sequences for d2jy7a2:

Sequence; same for both SEQRES and ATOM records:

>d2jy7a2 a.5.2.1 (A:3-52) Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [TaxId: 9606]}
ppeadprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqyskh

Timeline for d2jy7a2:

• d2jy7a2 first appeared in SCOP 1.75, called d2jy7a1
  
• d2jy7a2 appears in SCOPe 2.06
  
• d2jy7a2 appears in the current release, SCOPe 2.08