Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (23 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.10: Filamin repeat (rod domain) [81290] (4 proteins) Pfam PF00630 |
Protein Filamin a [141023] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141024] (5 PDB entries) Uniprot P21333 1863-1953! Uniprot P21333 1863-1955! Uniprot P21333 2236-2328 |
Domain d2jf1a1: 2jf1 A:2237-2328 [148028] automatically matched to d2brqa1 complexed with gol |
PDB Entry: 2jf1 (more details), 2.2 Å
SCOP Domain Sequences for d2jf1a1:
Sequence, based on SEQRES records: (download)
>d2jf1a1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} gahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgva yvvqepgdyevsvkfneehipdspfvvpvasp
>d2jf1a1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} gahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfescgvayvvqe pgdyevsvkfneehipdspfvvpvasp
Timeline for d2jf1a1: