Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134 |
Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) |
Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins) |
Protein Exosome complex exonuclease 2, ECX2 [160597] (2 species) |
Species Sulfolobus solfataricus [TaxId:2287] [160599] (6 PDB entries) Uniprot Q9UXC0 192-275 |
Domain d2jeaa2: 2jea A:192-275 [148009] Other proteins in same PDB: d2jeaa1, d2jeaa3, d2jeab1, d2jeab2, d2jeai1, d2jeai2, d2jeai3 automated match to d2je6a2 protein/RNA complex; complexed with 1pe |
PDB Entry: 2jea (more details), 2.33 Å
SCOPe Domain Sequences for d2jeaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jeaa2 d.101.1.1 (A:192-275) Exosome complex exonuclease 2, ECX2 {Sulfolobus solfataricus [TaxId: 2287]} plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi dqaentarstavklleelkkhlgi
Timeline for d2jeaa2: