Lineage for d2jb6h1 (2jb6 H:3-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2739899Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (30 PDB entries)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
  8. 2739937Domain d2jb6h1: 2jb6 H:3-120 [147959]
    Other proteins in same PDB: d2jb6a1, d2jb6a2, d2jb6b2, d2jb6h2, d2jb6l1, d2jb6l2
    automatically matched to d1nl0h1
    complexed with t5c

Details for d2jb6h1

PDB Entry: 2jb6 (more details), 2.85 Å

PDB Description: fab fragment in complex with small molecule hapten, crystal form-2
PDB Compounds: (H:) fab fragment mor03268 heavy chain

SCOPe Domain Sequences for d2jb6h1:

Sequence, based on SEQRES records: (download)

>d2jb6h1 b.1.1.1 (H:3-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
qlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmgniepyfgtanyaq
kfqgrvtitadeststaymelsslrsedtavyycaryfmsykhlsdywgqgtlvtvss

Sequence, based on observed residues (ATOM records): (download)

>d2jb6h1 b.1.1.1 (H:3-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
qlvqsgaevkkpgssvkvsckanyainwvrqapgqglewmgniepyfgtanyaqkfqgrv
titadeststaymelsslrsedtavyycaryfmsykhlsdywgqgtlvtvss

SCOPe Domain Coordinates for d2jb6h1:

Click to download the PDB-style file with coordinates for d2jb6h1.
(The format of our PDB-style files is described here.)

Timeline for d2jb6h1: