Lineage for d2ikbb_ (2ikb B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2926468Family d.2.1.9: NMB1012-like [159827] (3 proteins)
    Pfam PF05838; predicted lysozyme (DUF847)
  6. 2926479Protein automated matches [190715] (1 species)
    not a true protein
  7. 2926480Species Neisseria meningitidis [TaxId:122586] [187865] (1 PDB entry)
  8. 2926481Domain d2ikbb_: 2ikb B: [147718]
    Other proteins in same PDB: d2ikba1
    automated match to d2ikba1

Details for d2ikbb_

PDB Entry: 2ikb (more details), 1.7 Å

PDB Description: Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis
PDB Compounds: (B:) Hypothetical protein NMB1012

SCOPe Domain Sequences for d2ikbb_:

Sequence, based on SEQRES records: (download)

>d2ikbb_ d.2.1.9 (B:) automated matches {Neisseria meningitidis [TaxId: 122586]}
dkfnqfinrvlsheggyanhpkdpggetnwgitkrtaqangyngsmramtreqaisiyrk
afweryradqmpeavafqffdacvnhgygnaarmlqraagvpddgvigavslkainslpe
ndlllrfnaerlvfytklgtftsfgkgwvrrvaqnlihasa

Sequence, based on observed residues (ATOM records): (download)

>d2ikbb_ d.2.1.9 (B:) automated matches {Neisseria meningitidis [TaxId: 122586]}
dkfnqfinrvlsheggyanhpkdpggetnwgitkrtaqangyngsmramtreqaisiyrk
afweryradqmpeavafqffdacvnhgygnaarmlqraagvpddgvigavslkainslpe
ndlllrfnaerlvfytklkgwvrrvaqnlihasa

SCOPe Domain Coordinates for d2ikbb_:

Click to download the PDB-style file with coordinates for d2ikbb_.
(The format of our PDB-style files is described here.)

Timeline for d2ikbb_: