Lineage for d2ihta3 (2iht A:375-573)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592643Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1592644Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1592920Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 1592968Protein Carboxyethylarginine synthase [102335] (1 species)
  7. 1592969Species Streptomyces clavuligerus [TaxId:1901] [102336] (6 PDB entries)
  8. 1592970Domain d2ihta3: 2iht A:375-573 [147687]
    Other proteins in same PDB: d2ihta1, d2ihta2, d2ihtb1, d2ihtb2, d2ihtc1, d2ihtc2, d2ihtd1, d2ihtd2
    automated match to d1upaa3
    complexed with gol, mg, so4, tpp

Details for d2ihta3

PDB Entry: 2iht (more details), 2 Å

PDB Description: Carboxyethylarginine synthase from Streptomyces clavuligerus: SeMet structure
PDB Compounds: (A:) carboxyethylarginine synthase

SCOPe Domain Sequences for d2ihta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ihta3 c.36.1.9 (A:375-573) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
petyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfltsag
cssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnndtng
lielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelgrpfl
ievpvnydfqpggfgalsi

SCOPe Domain Coordinates for d2ihta3:

Click to download the PDB-style file with coordinates for d2ihta3.
(The format of our PDB-style files is described here.)

Timeline for d2ihta3: