Lineage for d2igsa1 (2igs A:4-215)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1397247Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1397248Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1398915Family d.2.1.11: PA2222-like [159837] (2 proteins)
    PfamB PB104465
    automatically mapped to Pfam PF11508
  6. 1398916Protein Hypothetical protein PA2222 [159838] (1 species)
  7. 1398917Species Pseudomonas aeruginosa [TaxId:287] [159839] (1 PDB entry)
    Uniprot Q9I1P7 4-215
  8. 1398918Domain d2igsa1: 2igs A:4-215 [147659]
    Other proteins in same PDB: d2igsb_, d2igsc_, d2igsd_, d2igse_, d2igsf_, d2igsg_, d2igsh_
    complexed with acy, gol, so4

Details for d2igsa1

PDB Entry: 2igs (more details), 2.17 Å

PDB Description: crystal structure of the protein of unknown function from pseudomonas aeruginosa
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2igsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2igsa1 d.2.1.11 (A:4-215) Hypothetical protein PA2222 {Pseudomonas aeruginosa [TaxId: 287]}
iniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdiskadqqy
stllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldrfkgsp
nvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpgvglrl
dapnfsdvfntiksglryttavtlllayfaai

SCOPe Domain Coordinates for d2igsa1:

Click to download the PDB-style file with coordinates for d2igsa1.
(The format of our PDB-style files is described here.)

Timeline for d2igsa1: