SCOPe 2.07: Domain d2if6b_: 2if6 B:

Lineage for d2if6b_ (2if6 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.21: YiiX-like [159855] (1 protein)
   Pfam PF06520; DUF1105; circularly permuted active site residues compare to papain

6. Protein Hypothetical protein YiiX [159856] (1 species)

7. Species Escherichia coli [TaxId:562] [159857] (1 PDB entry)
   Uniprot Q8X778 19-200

8. Domain d2if6b_: 2if6 B: [147652]
   automated match to d2if6a1
   complexed with unx

Details for d2if6b_

PDB Entry: 2if6, 1.8 Å

PDB Description: crystal structure of metalloprotein yiix from escherichia coli o157:h7, duf1105

PDB Compounds: (B:) Hypothetical protein yiiX

SCOPe Domain Sequences for d2if6b_:

Sequence; same for both SEQRES and ATOM records:

>d2if6b_ d.3.1.21 (B:) Hypothetical protein YiiX {Escherichia coli [TaxId: 562]}
wqpqtgdiifqisrssqskaiqlathsdyshtgmlvmrnkkpyvfeavgpvkytplkqwi
ahgekgkyvvrrvegglsveqqqklaqtakrylgkpydfsfswsddrqycsevvwkvyqn
algmrvgeqqklkefdlsnplvqaklkerygknipleetvvspqavfdapqlttvakewp

Timeline for d2if6b_:

• d2if6b_ first appeared in SCOP 1.75, called d2if6b1
  
• d2if6b_ appears in SCOPe 2.06
  
• d2if6b_ appears in the current release, SCOPe 2.08