SCOPe 2.07: Domain d2hqtj2: 2hqt J:3-122

Lineage for d2hqtj2 (2hqt J:3-122)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.2: Arc1p N-terminal domain-like [158491] (1 protein)
   PfamB PB021108

6. Protein GU4 nucleic-binding protein 1, Arc1p [158492] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [158493] (4 PDB entries)
   Uniprot P46672 4-121

8. Domain d2hqtj2: 2hqt J:3-122 [147350]
   Other proteins in same PDB: d2hqtf3, d2hqtj3
   automated match to d2hqta1
   complexed with so4

Details for d2hqtj2

PDB Entry: 2hqt, 1.9 Å

PDB Description: crystal structures of the interacting domains from yeast glutamyl-trna synthetase and trna aminoacylation and nuclear export cofactor arc1p reveal a novel function for an old fold

PDB Compounds: (J:) GU4 nucleic-binding protein 1

SCOPe Domain Sequences for d2hqtj2:

Sequence; same for both SEQRES and ATOM records:

>d2hqtj2 a.45.1.2 (J:3-122) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivst
lyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklein

Timeline for d2hqtj2:

• d2hqtj2 first appeared in SCOP 1.75, called d2hqtj1
  
• d2hqtj2 appears in SCOPe 2.06
  
• d2hqtj2 appears in the current release, SCOPe 2.08