Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (22 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.7: Adenain-like [54054] (5 proteins) Pfam PF02902; Ulp1 protease family |
Protein Ulp1 protease C-terminal domain [54057] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54058] (4 PDB entries) |
Domain d2hl8a1: 2hl8 A:401-621 [147307] automatically matched to d1euva_ |
PDB Entry: 2hl8 (more details), 2 Å
SCOP Domain Sequences for d2hl8a1:
Sequence, based on SEQRES records: (download)
>d2hl8a1 d.3.1.7 (A:401-621) Ulp1 protease C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gslvpelnekdddqvqkalasrentqlmnrdnieitvrdfktlaprrwlndtiieffmky iekstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgii dlkkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydc giyvcmntlygsadapldfdykdairmrrfiahliltdalk
>d2hl8a1 d.3.1.7 (A:401-621) Ulp1 protease C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gslvpelnekdddqvqkalasretqlmnrnieitvrdfktlaprrwlndtiieffmkyie kstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgiidl kkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydcgi yvcmntlygsadapldfdykdairmrrfiahliltdalk
Timeline for d2hl8a1: