SCOP 1.75: Domain d2hl8a1: 2hl8 A:401-621

Lineage for d2hl8a1 (2hl8 A:401-621)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (22 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (5 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein Ulp1 protease C-terminal domain [54057] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54058] (4 PDB entries)

8. Domain d2hl8a1: 2hl8 A:401-621 [147307]
   automatically matched to d1euva_

Details for d2hl8a1

PDB Entry: 2hl8, 2 Å

PDB Description: SUMO protease Ulp1 with the catalytic cysteine oxidized to a sulfinic acid

PDB Compounds: (A:) Ubiquitin-like-specific protease 1

SCOP Domain Sequences for d2hl8a1:

Sequence, based on SEQRES records:

>d2hl8a1 d.3.1.7 (A:401-621) Ulp1 protease C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gslvpelnekdddqvqkalasrentqlmnrdnieitvrdfktlaprrwlndtiieffmky
iekstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgii
dlkkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydc
giyvcmntlygsadapldfdykdairmrrfiahliltdalk

Sequence, based on observed residues (ATOM records):

>d2hl8a1 d.3.1.7 (A:401-621) Ulp1 protease C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gslvpelnekdddqvqkalasretqlmnrnieitvrdfktlaprrwlndtiieffmkyie
kstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgiidl
kkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydcgi
yvcmntlygsadapldfdykdairmrrfiahliltdalk

Timeline for d2hl8a1:

• d2hl8a1 is new in SCOP 1.75
  
• d2hl8a1 is called d2hl8a_ in SCOPe 2.01
  
• d2hl8a1 appears in the current release, SCOPe 2.08, called d2hl8a2