Lineage for d1euva_ (1euv A:)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily)
consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-AsnSuperfamily d.3.1: Cysteine proteinases [54001] (22 families) 
the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
Family d.3.1.7: Adenain-like [54054] (5 proteins)
Pfam PF02902; Ulp1 protease family
Protein Ulp1 protease C-terminal domain [54057] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54058] (4 PDB entries) 
Domain d1euva_: 1euv A: [37133]
Other proteins in same PDB: d1euvb_
Details for d1euva_
PDB Entry: 1euv (more details), 1.6 Å
PDB Description: x-ray structure of the c-terminal ulp1 protease domain in complex with smt3, the yeast ortholog of sumo.
PDB Compounds: (A:) ulp1 proteaseSCOP Domain Sequences for d1euva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1euva_ d.3.1.7 (A:) Ulp1 protease C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gslvpelnekdddqvqkalasrentqlmnrdnieitvrdfktlaprrwlndtiieffmky
iekstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgii
dlkkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydc
giyvcmntlygsadapldfdykdairmrrfiahliltdalk
SCOP Domain Coordinates for d1euva_:
Click to download the PDB-style file with coordinates for d1euva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1euva_:
- d1euva_ first appeared (with stable ids) in SCOP 1.55
- d1euva_ appears in SCOP 1.73
- d1euva_ appears in SCOPe 2.01
- d1euva_ appears in the current release, SCOPe 2.08, called d1euva1
View in 3D
