SCOPe 2.04: Domain d2ebfx1: 2ebf X:575-874

Lineage for d2ebfx1 (2ebf X:575-874)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.296: PMT central region-like [158841] (1 superfamily)
   multihelical; comprises two four-helical bundles of different topologies and an irregular helical array packed against a small beta-sheet

4. Superfamily a.296.1: PMT central region-like [158842] (1 family)

5. Family a.296.1.1: PMT central region-like [158843] (1 protein)

6. Protein Dermonecrotic toxin, ToxA [158844] (1 species)
   Synonym: Mitogenic toxin PMT

7. Species Pasteurella multocida [TaxId:747] [158845] (3 PDB entries)
   Uniprot P17452 575-874

8. Domain d2ebfx1: 2ebf X:575-874 [146766]
   Other proteins in same PDB: d2ebfx2, d2ebfx3
   complexed with 2po, tre

Details for d2ebfx1

PDB Entry: 2ebf, 1.9 Å

PDB Description: crystal structures reveal a thiol-protease like catalytic triad in the c-terminal region of pasteurella multocida toxin

PDB Compounds: (X:) Dermonecrotic toxin

SCOPe Domain Sequences for d2ebfx1:

Sequence; same for both SEQRES and ATOM records:

>d2ebfx1 a.296.1.1 (X:575-874) Dermonecrotic toxin, ToxA {Pasteurella multocida [TaxId: 747]}
lggspyspfriglegvwtpevlkarasvigkpigesykrilaklqrihnsnilderqglm
helmelidlyeesqpsserlnafrelrtqlekalylpemealkkqilqipnkgsgaarfl
lrtamnemagktsestadlirfalqdtvisapfrgyagaipeaidfpvkyviedisvfdk
iqtnywelpayeswnegsnsallpgllresqskgmlskcriienslyighsyeemfysis
pysnqvggpyelypftffsmlqevqgdlgfeqafatrnffntlvsdrlslmentmlltes

Timeline for d2ebfx1:

• d2ebfx1 first appeared in SCOP 1.75
  
• d2ebfx1 appears in SCOPe 2.03
  
• d2ebfx1 appears in SCOPe 2.05
  
• d2ebfx1 appears in the current release, SCOPe 2.08