Lineage for d2e35a2 (2e35 A:2-68)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1411943Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 1411944Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 1411945Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 1411949Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 1411988Species Thermus thermophilus [TaxId:274] [160200] (17 PDB entries)
    Uniprot P36238 1-70! Uniprot P36238 2-68! Uniprot P36238 2-70
  8. 1412002Domain d2e35a2: 2e35 A:2-68 [146673]
    Other proteins in same PDB: d2e35a1
    automatically matched to 2HGJ L:2-68

Details for d2e35a2

PDB Entry: 2e35 (more details)

PDB Description: the minimized average structure of l11 with rg refinement
PDB Compounds: (A:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2e35a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e35a2 d.47.1.1 (A:2-68) Ribosomal protein L11, N-terminal domain {Thermus thermophilus [TaxId: 274]}
kkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiya
drsftfv

SCOPe Domain Coordinates for d2e35a2:

Click to download the PDB-style file with coordinates for d2e35a2.
(The format of our PDB-style files is described here.)

Timeline for d2e35a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2e35a1