SCOPe 2.07: Domain d2e0ha_: 2e0h A:

Lineage for d2e0ha_ (2e0h A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.7: Scorpion toxin-like [57095] (6 families)

5. Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins)

6. Protein alpha toxin [57111] (4 species)
   Anti-mammal and anti-insect scorpion toxin

7. Species Chinese scorpion (Buthus martensii karsch) [TaxId:34649] [103539] (2 PDB entries)

8. Domain d2e0ha_: 2e0h A: [146622]
   automated match to d1omya_

Details for d2e0ha_

PDB Entry: 2e0h

PDB Description: solution structure of bmkalphait01, an alpha-insect toxin from the venom of the chinese scorpion buthus martensi karsch

PDB Compounds: (A:) Alpha-neurotoxin TX12

SCOPe Domain Sequences for d2e0ha_:

Sequence; same for both SEQRES and ATOM records:

>d2e0ha_ g.3.7.1 (A:) alpha toxin {Chinese scorpion (Buthus martensii karsch) [TaxId: 34649]}
vrdayiaqnyncvyhcardaycnelctkngaksgscpylgehkfacyckdlpdnvpirvp
gkch

Timeline for d2e0ha_:

• d2e0ha_ first appeared in SCOP 1.75, called d2e0ha1
  
• d2e0ha_ appears in SCOPe 2.06
  
• d2e0ha_ appears in the current release, SCOPe 2.08