![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.22: ASF1-like [101546] (2 families) ![]() contains extra C-terminal strand automatically mapped to Pfam PF04729 |
![]() | Family b.1.22.1: ASF1-like [101547] (2 proteins) |
![]() | Protein Anti-silencing protein 1, ASF1 [101548] (3 species) |
![]() | Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [158909] (4 PDB entries) Uniprot O74515 1-161 |
![]() | Domain d2dzea_: 2dze A: [146615] automated match to d2cu9a1 complexed with pge |
PDB Entry: 2dze (more details), 1.8 Å
SCOPe Domain Sequences for d2dzea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dzea_ b.1.22.1 (A:) Anti-silencing protein 1, ASF1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} msivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtl lvgpipiginkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemeg lnlqemddaeikkvkvdiskvwrsilaekprvtrfniqwd
Timeline for d2dzea_: