Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins) |
Protein 3C cysteine protease (picornain 3C) [50604] (4 species) |
Species Foot-and-mouth disease virus FMDV [TaxId:12110] [159189] (2 PDB entries) Uniprot P49303 1657-1755! Uniprot P49303 1657-1857 |
Domain d2bhga1: 2bhg A:7-205 [146141] mutant |
PDB Entry: 2bhg (more details), 1.9 Å
SCOP Domain Sequences for d2bhga1:
Sequence, based on SEQRES records: (download)
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} dlqkmvmgntkpvelnldgktvaiccatgvfgtaylvprhlfaekydkimldgramtdsd yrvfefeikvkgqdmlsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgr lifsgealtykdivvsmdgdtmpglfaykaatragyaggavlakdgadtfivgthsaggn gvgycscvsrsmlqkmkah
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} dlqkmvmgntkpvelnldgktvaiccatgvfgtaylvprhlfaekydkimldgramtdsd yrvfefeikvkgqdmlsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgr lifsgealtykdivvtmpglfaykaatragyaggavlakdgadtfivgthsaggngvgyc scvsrsmlqkmkah
Timeline for d2bhga1: