Lineage for d1zj8b2 (1zj8 B:10-161)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1418118Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (2 families) (S)
    duplication: contains two subdomains of this fold
  5. 1418119Family d.58.36.1: Duplicated SiR/NiR-like domains 1 and 3 [55125] (3 proteins)
  6. 1418124Protein Sulfite reductase NirA [160334] (1 species)
  7. 1418125Species Mycobacterium tuberculosis [TaxId:1773] [160335] (2 PDB entries)
    Uniprot P71753 10-161! Uniprot P71753 327-406
  8. 1418129Domain d1zj8b2: 1zj8 B:10-161 [146008]
    Other proteins in same PDB: d1zj8a3, d1zj8a4, d1zj8b3, d1zj8b4
    automated match to d1zj8a2
    complexed with cl, sf4, srm

Details for d1zj8b2

PDB Entry: 1zj8 (more details), 2.8 Å

PDB Description: structure of mycobacterium tuberculosis nira protein
PDB Compounds: (B:) Probable ferredoxin-dependent nitrite reductase NirA

SCOPe Domain Sequences for d1zj8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zj8b2 d.58.36.1 (B:10-161) Sulfite reductase NirA {Mycobacterium tuberculosis [TaxId: 1773]}
rnegqwalghreplnaneelkkagnpldvrerieniyakqgfdsidktdlrgrfrwwgly
tqreqgydgtwtgddnidkleakyfmmrvrcdggalsaaalrtlgqistefardtadisd
rqnvqyhwievenvpeiwrrlddvglqtteac

SCOPe Domain Coordinates for d1zj8b2:

Click to download the PDB-style file with coordinates for d1zj8b2.
(The format of our PDB-style files is described here.)

Timeline for d1zj8b2: