Lineage for d1z0nb_ (1z0n B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299386Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1300211Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins)
    lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G)
  6. 1300223Protein automated matches [190844] (1 species)
    not a true protein
  7. 1300224Species Norway rat (Rattus norvegicus) [TaxId:10116] [188163] (2 PDB entries)
  8. 1300225Domain d1z0nb_: 1z0n B: [145956]
    Other proteins in same PDB: d1z0na1
    automated match to d1z0na1
    complexed with bcd

Details for d1z0nb_

PDB Entry: 1z0n (more details), 1.49 Å

PDB Description: the glycogen-binding domain of the amp-activated protein kinase
PDB Compounds: (B:) 5'-AMP-activated protein kinase, beta-1 subunit

SCOPe Domain Sequences for d1z0nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z0nb_ b.1.18.21 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
arptvfrwtgggkevylsgsfnnwsklpmtrsqnnfvaildlpegehqykffvdgqwthd
psepivtsqlgtvnniiqvk

SCOPe Domain Coordinates for d1z0nb_:

Click to download the PDB-style file with coordinates for d1z0nb_.
(The format of our PDB-style files is described here.)

Timeline for d1z0nb_: