Lineage for d1ywhk2 (1ywh K:1-78)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890226Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 890227Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 890414Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 890476Protein Urokinase plasminogen activator surface receptor, UPAR [161130] (1 species)
    duplication; comprises three domains of this fold
  7. 890477Species Human (Homo sapiens) [TaxId:9606] [161131] (4 PDB entries)
    Uniprot Q03405 111-210! Uniprot Q03405 114-210! Uniprot Q03405 211-297! Uniprot Q03405 211-301! Uniprot Q03405 23-102! Uniprot Q03405 23-104
  8. 890500Domain d1ywhk2: 1ywh K:1-78 [145941]
    automatically matched to 1YWH A:1-82
    complexed with alc, bma, fuc, man, nag, ndg, so4

Details for d1ywhk2

PDB Entry: 1ywh (more details), 2.7 Å

PDB Description: crystal structure of urokinase plasminogen activator receptor
PDB Compounds: (K:) Urokinase plasminogen activator surface receptor

SCOP Domain Sequences for d1ywhk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ywhk2 g.7.1.3 (K:1-78) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]}
lrcmqcktngdcrveecalgqdlcrttivrlweegeelelvekscthsektnrtlsyrtg
lkitsltevvcgldlcnq

SCOP Domain Coordinates for d1ywhk2:

Click to download the PDB-style file with coordinates for d1ywhk2.
(The format of our PDB-style files is described here.)

Timeline for d1ywhk2: