Class g: Small proteins [56992] (90 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (3 families) |
Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) |
Protein Urokinase plasminogen activator surface receptor, UPAR [161130] (1 species) duplication; comprises three domains of this fold |
Species Human (Homo sapiens) [TaxId:9606] [161131] (4 PDB entries) Uniprot Q03405 111-210! Uniprot Q03405 114-210! Uniprot Q03405 211-297! Uniprot Q03405 211-301! Uniprot Q03405 23-102! Uniprot Q03405 23-104 |
Domain d1ywha3: 1ywh A:189-279 [145927] complexed with alc, bma, fuc, man, nag, ndg, so4 |
PDB Entry: 1ywh (more details), 2.7 Å
SCOP Domain Sequences for d1ywha3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ywha3 g.7.1.3 (A:189-279) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]} qngrqcysckgqsthgcsseetflidcrgpmnqclvatgthepknqsymvrgcatasmcq hahlgdafsmnhidvscctksgcnhpdldvq
Timeline for d1ywha3: