Lineage for d2omwb1 (2omw B:2-100)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1298299Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 1298300Family b.1.6.1: Cadherin [49314] (3 proteins)
  6. 1298308Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 1298323Species Mouse (Mus musculus) [TaxId:10090] [49318] (13 PDB entries)
  8. 1298328Domain d2omwb1: 2omw B:2-100 [145724]
    Other proteins in same PDB: d2omwa1, d2omwa2
    complexed with cl

Details for d2omwb1

PDB Entry: 2omw (more details), 1.85 Å

PDB Description: crystal structure of inla s192n y369s/mec1 complex
PDB Compounds: (B:) epithelial-cadherin

SCOPe Domain Sequences for d2omwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2omwb1 b.1.6.1 (B:2-100) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
wvippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwlk
vtqpldreaiakyilyshavssngnavedpmeivitvtd

SCOPe Domain Coordinates for d2omwb1:

Click to download the PDB-style file with coordinates for d2omwb1.
(The format of our PDB-style files is described here.)

Timeline for d2omwb1: