Lineage for d2i2pu1 (2i2p U:3-53)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3047535Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 3047536Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) (S)
  5. 3047537Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
    Pfam PF01165
  6. 3047538Protein Ribosomal protein S21, RpsU [161310] (1 species)
  7. 3047539Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
    Uniprot P68679 4-54
  8. 3047546Domain d2i2pu1: 2i2p U:3-53 [145440]
    Other proteins in same PDB: d2i2pb1, d2i2pc1, d2i2pc2, d2i2pd1, d2i2pe1, d2i2pe2, d2i2pf1, d2i2pg1, d2i2ph1, d2i2pi1, d2i2pj1, d2i2pk1, d2i2pl1, d2i2pm1, d2i2pn1, d2i2po1, d2i2pp1, d2i2pq1, d2i2pr1, d2i2ps1, d2i2pt1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2i2pu1

PDB Entry: 2i2p (more details), 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (U:) 30S ribosomal protein S21

SCOPe Domain Sequences for d2i2pu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2pu1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

SCOPe Domain Coordinates for d2i2pu1:

Click to download the PDB-style file with coordinates for d2i2pu1.
(The format of our PDB-style files is described here.)

Timeline for d2i2pu1: