Lineage for d2i2po1 (2i2p O:1-88)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697722Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 2697723Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 2697777Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
    automatically mapped to Pfam PF00312
  6. 2697778Protein Ribosomal protein S15 [47065] (3 species)
  7. 2697781Species Escherichia coli [TaxId:562] [158383] (10 PDB entries)
    Uniprot Q8X9M2 2-89
  8. 2697782Domain d2i2po1: 2i2p O:1-88 [145434]
    Other proteins in same PDB: d2i2pb1, d2i2pc1, d2i2pc2, d2i2pd1, d2i2pe1, d2i2pe2, d2i2pf1, d2i2pg1, d2i2ph1, d2i2pi1, d2i2pj1, d2i2pk1, d2i2pl1, d2i2pm1, d2i2pn1, d2i2pp1, d2i2pq1, d2i2pr1, d2i2ps1, d2i2pt1, d2i2pu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2i2po1

PDB Entry: 2i2p (more details), 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (O:) 30S ribosomal protein S15

SCOPe Domain Sequences for d2i2po1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2po1 a.16.1.2 (O:1-88) Ribosomal protein S15 {Escherichia coli [TaxId: 562]}
slsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmvs
qrrklldylkrkdvarytrlierlglrr

SCOPe Domain Coordinates for d2i2po1:

Click to download the PDB-style file with coordinates for d2i2po1.
(The format of our PDB-style files is described here.)

Timeline for d2i2po1: