SCOP 1.75: Domain d2gybi1: 2gyb I:4-129

Lineage for d2gybi1 (2gyb I:4-129)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S9 [54218] (2 species)

7. Species Escherichia coli [TaxId:562] [159907] (26 PDB entries)
   Uniprot P0A7X3 3-129

8. Domain d2gybi1: 2gyb I:4-129 [145256]
   Other proteins in same PDB: d2gybb1, d2gybd1, d2gybh1, d2gybm1, d2gybp1, d2gybq1, d2gybs1, d2gybt1
   automatically matched to 2AVY I:3-129

Details for d2gybi1

PDB Entry: 2gyb, 2 Å

PDB Description: Structure of the 30S subunit of a SecM-stalled E. coli ribosome complex obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1143

PDB Compounds: (I:) 30S ribosomal subunit protein S9

SCOP Domain Sequences for d2gybi1:

Sequence; same for both SEQRES and ATOM records:

>d2gybi1 d.14.1.1 (I:4-129) Ribosomal protein S9 {Escherichia coli [TaxId: 562]}
qyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekldly
itvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrkarrr
pqfskr

Timeline for d2gybi1:

• d2gybi1 is new in SCOP 1.75
  
• d2gybi1 appears in SCOPe 2.01
  
• d2gybi1 appears in the current release, SCOPe 2.08