Lineage for d2gsif1 (2gsi F:2-114)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353147Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (31 PDB entries)
    SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)
  8. 2353176Domain d2gsif1: 2gsi F:2-114 [145225]
    Other proteins in same PDB: d2gsia1, d2gsia2, d2gsib2, d2gsic1, d2gsic2, d2gsid2, d2gsie1, d2gsie2, d2gsif2, d2gsig1, d2gsig2, d2gsih2
    automatically matched to 2GSI B:2-114
    complexed with na

Details for d2gsif1

PDB Entry: 2gsi (more details), 2.81 Å

PDB Description: crystal structure of a murine fab in complex with an 11 residue peptide derived from staphylococcal nuclease
PDB Compounds: (F:) Immunoglobulin (gamma) heavy chain (VH + CH1 fragment)

SCOPe Domain Sequences for d2gsif1:

Sequence, based on SEQRES records: (download)

>d2gsif1 b.1.1.1 (F:2-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
vqlqqsgaelvrsgasvklsctasgfnikdyymywvklrpeqglewigwidpengdteyv
ptfqgkvtmtadtssntaylqlssltsedtavyycnagvitmmgyqamdywgqgttvtts
sa

Sequence, based on observed residues (ATOM records): (download)

>d2gsif1 b.1.1.1 (F:2-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
vqlqqsgaelvrsgasvklsctasgfnikdyymywvklrpeqglewigwidpengdteyv
ptfqgkvtmtadtssntaylqlssltsedtavyycnagvitmamdywgqgttvttssa

SCOPe Domain Coordinates for d2gsif1:

Click to download the PDB-style file with coordinates for d2gsif1.
(The format of our PDB-style files is described here.)

Timeline for d2gsif1: