Lineage for d2fyuk_ (2fyu K:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026085Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family) (S)
    automatically mapped to Pfam PF08997
  5. 3026086Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (2 proteins)
  6. 3026102Protein automated matches [190648] (1 species)
    not a true protein
  7. 3026103Species Cow (Bos taurus) [TaxId:9913] [187726] (5 PDB entries)
  8. 3026104Domain d2fyuk_: 2fyu K: [145179]
    Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyue1, d2fyue2, d2fyuf_, d2fyug_, d2fyuh_, d2fyui_, d2fyuj_
    automated match to d1sqqk1
    complexed with fdn, fes, hem

Details for d2fyuk_

PDB Entry: 2fyu (more details), 2.26 Å

PDB Description: Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
PDB Compounds: (K:) Ubiquinol-cytochrome c reductase complex 6.4 kDa protein

SCOPe Domain Sequences for d2fyuk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fyuk_ f.23.15.1 (K:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mltrflgpryrqlarnwvptaslwgavgavglvwatdwrlildwvpyingkfk

SCOPe Domain Coordinates for d2fyuk_:

Click to download the PDB-style file with coordinates for d2fyuk_.
(The format of our PDB-style files is described here.)

Timeline for d2fyuk_: