SCOP 1.75: Domain d2cdec2: 2cde C:116-193

Lineage for d2cdec2 (2cde C:116-193)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (16 PDB entries)

8. Domain d2cdec2: 2cde C:116-193 [145030]
   Other proteins in same PDB: d2cdea1, d2cdeb1, d2cded1, d2cdef1
   automatically matched to 2CDE A:116-193

Details for d2cdec2

PDB Entry: 2cde, 3.5 Å

PDB Description: structure and binding kinetics of three different human cd1d-alpha-galactosylceramide specific t cell receptors -inkt-tcr

PDB Compounds: (C:) inkt-tcr

SCOP Domain Sequences for d2cdec2:

Sequence; same for both SEQRES and ATOM records:

>d2cdec2 b.1.1.2 (C:116-193) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqkpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnn

Timeline for d2cdec2:

• d2cdec2 is new in SCOP 1.75
  
• d2cdec2 appears in SCOPe 2.01
  
• d2cdec2 appears in the current release, SCOPe 2.08