SCOPe 2.08: Domain d2bs4f_: 2bs4 F:

Lineage for d2bs4f_ (2bs4 F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families)
   two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains

5. Family f.21.2.1: Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56910] (2 proteins)
   duplication: consists of two structural repeats; the heme-binding sites are related by pseudo two fold symmetry

6. Protein automated matches [190227] (1 species)
   not a true protein

7. Species Wolinella succinogenes [TaxId:844] [186991] (3 PDB entries)

8. Domain d2bs4f_: 2bs4 F: [145008]
   Other proteins in same PDB: d2bs4a1, d2bs4a2, d2bs4a3, d2bs4b1, d2bs4b2, d2bs4c1, d2bs4d1, d2bs4d2, d2bs4d3, d2bs4e1, d2bs4e2
   automated match to d2bs4c1
   complexed with cit, dmw, f3s, fad, fes, hem, lmt, na, sf4

Details for d2bs4f_

PDB Entry: 2bs4, 2.76 Å

PDB Description: glu c180 -> ile variant quinol:fumarate reductase from wolinella succinogenes

PDB Compounds: (F:) quinol-fumarate reductase diheme cytochrome b subunit c

SCOPe Domain Sequences for d2bs4f_:

Sequence; same for both SEQRES and ATOM records:

>d2bs4f_ f.21.2.1 (F:) automated matches {Wolinella succinogenes [TaxId: 844]}
mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfavi
lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
pnidykyfdykrthh

Timeline for d2bs4f_:

• d2bs4f_ first appeared in SCOP 1.75, called d2bs4f1
  
• d2bs4f_ appears in SCOPe 2.07