SCOPe 2.08: Domain d2b9nv1: 2b9n V:5-98

Lineage for d2b9nv1 (2b9n V:5-98)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.155: L21p-like [141090] (1 superfamily)
   core: sandwich, 6 strands in 2 sheets

4. Superfamily b.155.1: L21p-like [141091] (1 family)
   automatically mapped to Pfam PF00829

5. Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
   Pfam PF00829

6. Protein Ribosomal protein L21p [141093] (3 species)

7. Species Thermus thermophilus [TaxId:274] [158939] (15 PDB entries)
   Uniprot P60492 1-101

8. Domain d2b9nv1: 2b9n V:5-98 [144974]
   Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1

Details for d2b9nv1

PDB Entry: 2b9n, 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.

PDB Compounds: (V:) 50S ribosomal protein L21

SCOPe Domain Sequences for d2b9nv1:

Sequence; same for both SEQRES and ATOM records:

>d2b9nv1 b.155.1.1 (V:5-98) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]}
iqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaevvehg
rgkkiyirkyksgvqyrrrtghrqnftaikilgi

Timeline for d2b9nv1:

• d2b9nv1 first appeared in SCOP 1.75
  
• d2b9nv1 appears in SCOPe 2.07