SCOPe 2.03: Domain d2aw4g2: 2aw4 G:82-176

Lineage for d2aw4g2 (2aw4 G:82-176)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)
   automatically mapped to Pfam PF00347

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Escherichia coli [TaxId:562] [160796] (27 PDB entries)
   Uniprot P02390 1-81! Uniprot P02390 82-176

8. Domain d2aw4g2: 2aw4 G:82-176 [144871]
   Other proteins in same PDB: d2aw401, d2aw411, d2aw421, d2aw431, d2aw441, d2aw4c1, d2aw4c2, d2aw4d1, d2aw4e1, d2aw4f1, d2aw4h1, d2aw4h2, d2aw4i1, d2aw4i2, d2aw4j1, d2aw4k1, d2aw4l1, d2aw4m1, d2aw4n1, d2aw4o1, d2aw4p1, d2aw4q1, d2aw4r1, d2aw4s1, d2aw4t1, d2aw4u1, d2aw4v1, d2aw4w1, d2aw4x1, d2aw4y1, d2aw4z1
   Representative structure
   protein/RNA complex; complexed with mg

Details for d2aw4g2

PDB Entry: 2aw4, 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 50S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (G:) 50S ribosomal protein L6

SCOPe Domain Sequences for d2aw4g2:

Sequence; same for both SEQRES and ATOM records:

>d2aw4g2 d.141.1.1 (G:82-176) Ribosomal protein L6 {Escherichia coli [TaxId: 562]}
ftkklqlvgvgyraavkgnvinlslgfshpvdhqlpagitaecptqteivlkgadkqvig
qvaadlrayrrpepykgkgvryadevvrtkeakkk

Timeline for d2aw4g2:

• d2aw4g2 first appeared in SCOP 1.75
  
• d2aw4g2 appears in SCOPe 2.02
  
• d2aw4g2 appears in SCOPe 2.04
  
• d2aw4g2 appears in the current release, SCOPe 2.08