Lineage for d2ak4u1 (2ak4 U:3-118)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741896Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2741924Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)
  8. 2741945Domain d2ak4u1: 2ak4 U:3-118 [144822]
    Other proteins in same PDB: d2ak4a1, d2ak4a2, d2ak4b_, d2ak4d2, d2ak4e2, d2ak4f1, d2ak4f2, d2ak4g_, d2ak4i2, d2ak4j2, d2ak4k1, d2ak4k2, d2ak4l_, d2ak4n2, d2ak4p2, d2ak4q1, d2ak4q2, d2ak4r_, d2ak4t2, d2ak4u2
    automatically matched to 2AK4 E:3-118
    complexed with iod

Details for d2ak4u1

PDB Entry: 2ak4 (more details), 2.5 Å

PDB Description: Crystal Structure of SB27 TCR in complex with HLA-B*3508-13mer peptide
PDB Compounds: (U:) SB27 T cell receptor beta chain

SCOPe Domain Sequences for d2ak4u1:

Sequence, based on SEQRES records: (download)

>d2ak4u1 b.1.1.1 (U:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevpn
gynvsrlnkrefslrlesaapsqtsvyfcaspglageyeqyfgpgtrltvte

Sequence, based on observed residues (ATOM records): (download)

>d2ak4u1 b.1.1.1 (U:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevpn
gynvsrlnkrefslrlesaapsqtsvyfcaspglaeqyfgpgtrltvte

SCOPe Domain Coordinates for d2ak4u1:

Click to download the PDB-style file with coordinates for d2ak4u1.
(The format of our PDB-style files is described here.)

Timeline for d2ak4u1: