![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.9: Defensin-like [57391] (1 superfamily) Disulfide-rich fold, nearly all-beta |
![]() | Superfamily g.9.1: Defensin-like [57392] (3 families) ![]() |
![]() | Family g.9.1.3: Tick carboxypeptidase inhibitor-like [161135] (1 protein) |
![]() | Protein Carboxypeptidase inhibitor [161136] (1 species) consists of two structurally similar to beta-defensin domains |
![]() | Species Tick (Rhipicephalus bursa) [TaxId:67831] [161137] (5 PDB entries) Uniprot Q5EPH2 23-59! Uniprot Q5EPH2 60-96 |
![]() | Domain d1zlib1: 1zli B:1-37 [144744] Other proteins in same PDB: d1zlia1 automated match to d1zlhb1 complexed with zn |
PDB Entry: 1zli (more details), 2.09 Å
SCOPe Domain Sequences for d1zlib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zlib1 g.9.1.3 (B:1-37) Carboxypeptidase inhibitor {Tick (Rhipicephalus bursa) [TaxId: 67831]} necvskgfgclpqsdcpqearlsyggcstvccdlskl
Timeline for d1zlib1: