Lineage for d1yi2g1 (1yi2 G:12-73)

  1. Root: SCOP 1.75
  2. 899091Class j: Peptides [58231] (121 folds)
  3. 900578Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 900579Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 900580Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 900581Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 900582Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
    Uniprot P15825
  8. 900593Domain d1yi2g1: 1yi2 G:12-73 [144639]
    Other proteins in same PDB: d1yi211, d1yi221, d1yi231, d1yi2a1, d1yi2a2, d1yi2b1, d1yi2c1, d1yi2d1, d1yi2e1, d1yi2e2, d1yi2f1, d1yi2h1, d1yi2i1, d1yi2j1, d1yi2k1, d1yi2l1, d1yi2m1, d1yi2n1, d1yi2o1, d1yi2p1, d1yi2q1, d1yi2r1, d1yi2s1, d1yi2t1, d1yi2u1, d1yi2v1, d1yi2w1, d1yi2x1, d1yi2y1, d1yi2z1
    automatically matched to 1VQ4 G:12-73
    complexed with 1ma, cd, cl, ery, k, mg, na, omg, omu, psu, ur3; mutant

Details for d1yi2g1

PDB Entry: 1yi2 (more details), 2.65 Å

PDB Description: crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (G:) Acidic ribosomal protein P0 homolog

SCOP Domain Sequences for d1yi2g1:

Sequence, based on SEQRES records: (download)

>d1yi2g1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Archaeon Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1yi2g1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Archaeon Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOP Domain Coordinates for d1yi2g1:

Click to download the PDB-style file with coordinates for d1yi2g1.
(The format of our PDB-style files is described here.)

Timeline for d1yi2g1: