SCOPe 2.08: Domain d1vs5n1: 1vs5 N:1-100

Lineage for d1vs5n1 (1vs5 N:1-100)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (2 species)

7. Species Escherichia coli [TaxId:562] [161162] (24 PDB entries)
   Uniprot P02370 1-100

8. Domain d1vs5n1: 1vs5 N:1-100 [144448]
   Other proteins in same PDB: d1vs5b1, d1vs5c1, d1vs5c2, d1vs5d1, d1vs5e1, d1vs5e2, d1vs5f1, d1vs5g1, d1vs5h1, d1vs5i1, d1vs5j1, d1vs5k1, d1vs5l1, d1vs5m1, d1vs5o1, d1vs5p1, d1vs5q1, d1vs5r1, d1vs5s1, d1vs5t1, d1vs5u1
   complexed with ksg, mg
   complexed with ksg, mg
   has additional insertions and/or extensions that are not grouped together

Details for d1vs5n1

PDB Entry: 1vs5, 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5A resolution. this file contains the 30s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.

PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d1vs5n1:

Sequence, based on SEQRES records:

>d1vs5n1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}
akqsmkarevkrvaladkyfakraelkaiisdvnasdedrwnavlklqtlprdsspsrqr
nrcrqtgrphgflrkfglsrikvreaamrgeipglkkasw

Sequence, based on observed residues (ATOM records):

>d1vs5n1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}
akqsmkarevkrvaladkyfakraelkaiisdvnarwnavlklqtlprdsspsrqrnrcr
qtgrphgflrkfglsrikvreaamrgeipglkkasw

Timeline for d1vs5n1:

• d1vs5n1 first appeared in SCOP 1.75
  
• d1vs5n1 appears in SCOPe 2.07