SCOP 1.75: Domain d1vqmg1: 1vqm G:12-73

Lineage for d1vqmg1 (1vqm G:12-73)

1. Root: SCOP 1.75

2. Class j: Peptides [58231] (121 folds)

3. Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)

4. Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family)

5. Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)

6. Protein Ribosomal protein L10 [64661] (1 species)
   two alpha-helical segments visible in the crystal structure

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
   Uniprot P15825

8. Domain d1vqmg1: 1vqm G:12-73 [144426]
   Other proteins in same PDB: d1vqm11, d1vqm21, d1vqm31, d1vqma1, d1vqma2, d1vqmb1, d1vqmc1, d1vqmd1, d1vqme1, d1vqme2, d1vqmf1, d1vqmh1, d1vqmi1, d1vqmj1, d1vqmk1, d1vqml1, d1vqmm1, d1vqmn1, d1vqmo1, d1vqmp1, d1vqmq1, d1vqmr1, d1vqms1, d1vqmt1, d1vqmu1, d1vqmv1, d1vqmw1, d1vqmx1, d1vqmy1, d1vqmz1
   automatically matched to 1VQ4 G:12-73
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, po2, ppu, psu, sr, ur3

Details for d1vqmg1

PDB Entry: 1vqm, 2.3 Å

PDB Description: the structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (G:) Acidic ribosomal protein P0 homolog

SCOP Domain Sequences for d1vqmg1:

Sequence, based on SEQRES records:

>d1vqmg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Archaeon Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records):

>d1vqmg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Archaeon Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

Timeline for d1vqmg1:

• d1vqmg1 is new in SCOP 1.75
  
• d1vqmg1 appears in SCOPe 2.01
  
• d1vqmg1 appears in the current release, SCOPe 2.08