SCOPe 2.08: Domain d1sqpk1: 1sqp K:1-53

Lineage for d1sqpk1 (1sqp K:1-53)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family)
   automatically mapped to Pfam PF08997

5. Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (2 proteins)

6. Protein Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81516] (1 species)
   the smallest subunit of the complex, interacts with subunit 10 and ISP, peripherally located

7. Species Cow (Bos taurus) [TaxId:9913] [81515] (12 PDB entries)
   Uniprot P07552

8. Domain d1sqpk1: 1sqp K:1-53 [144376]
   Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpe1, d1sqpe2, d1sqpf1, d1sqpg_, d1sqph_, d1sqpi_, d1sqpj_
   complexed with cdl, fes, hec, myx, pee, plx

Details for d1sqpk1

PDB Entry: 1sqp, 2.7 Å

PDB Description: crystal structure analysis of bovine bc1 with myxothiazol

PDB Compounds: (K:) Ubiquinol-cytochrome c reductase complex 6.4 kDa protein

SCOPe Domain Sequences for d1sqpk1:

Sequence; same for both SEQRES and ATOM records:

>d1sqpk1 f.23.15.1 (K:1-53) Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
mltrflgpryrqlarnwvptaglwgavgavglvwatdwrlildwvpyingkfk

Timeline for d1sqpk1:

• d1sqpk1 first appeared in SCOP 1.75
  
• d1sqpk1 appears in SCOPe 2.07