Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) automatically mapped to Pfam PF01194 |
Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins) Zn-binding site is near the N-terminus |
Protein RNA polymerase subunit RPB10 [46926] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (28 PDB entries) Uniprot P22139; part of multichain biological unit |
Domain d2yu9j1: 2yu9 J:1-65 [140074] Other proteins in same PDB: d2yu9a1, d2yu9b1, d2yu9c1, d2yu9c2, d2yu9e1, d2yu9e2, d2yu9f1, d2yu9h1, d2yu9i1, d2yu9i2, d2yu9k1, d2yu9l1 automatically matched to d1i3qj_ protein/DNA complex; protein/RNA complex; complexed with mg, utp, zn |
PDB Entry: 2yu9 (more details), 3.4 Å
SCOPe Domain Sequences for d2yu9j1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yu9j1 a.4.11.1 (J:1-65) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf lrynp
Timeline for d2yu9j1: