Lineage for d2yu9i2 (2yu9 I:50-120)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464070Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) (S)
  5. 1464071Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins)
  6. 1464072Protein RBP9 subunit of RNA polymerase II [57787] (3 species)
    contains two differently decorated domains of this fold
  7. 1464073Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
    Uniprot P27999; part of multichain biological unit
  8. 1464115Domain d2yu9i2: 2yu9 I:50-120 [140073]
    Other proteins in same PDB: d2yu9a1, d2yu9b1, d2yu9c1, d2yu9c2, d2yu9e1, d2yu9e2, d2yu9f1, d2yu9h1, d2yu9j1, d2yu9k1, d2yu9l1
    automatically matched to d1i3qi2
    protein/DNA complex; protein/RNA complex; complexed with mg, utp, zn

Details for d2yu9i2

PDB Entry: 2yu9 (more details), 3.4 Å

PDB Description: rna polymerase ii elongation complex in 150 mm mg+2 with utp
PDB Compounds: (I:) DNA-directed RNA polymerase II subunit 9

SCOPe Domain Sequences for d2yu9i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yu9i2 g.41.3.1 (I:50-120) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtq

SCOPe Domain Coordinates for d2yu9i2:

Click to download the PDB-style file with coordinates for d2yu9i2.
(The format of our PDB-style files is described here.)

Timeline for d2yu9i2: