Class a: All alpha proteins [46456] (289 folds) |
Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
Family a.143.1.2: RPB6 [55294] (2 proteins) |
Protein RPB6 [55295] (3 species) essential subunit of RNA polymerases I, II and III |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (31 PDB entries) Uniprot P20435; part of multichain biological unit |
Domain d2yu9f1: 2yu9 F:72-155 [140070] Other proteins in same PDB: d2yu9a1, d2yu9b1, d2yu9c1, d2yu9c2, d2yu9e1, d2yu9e2, d2yu9h1, d2yu9i1, d2yu9i2, d2yu9j1, d2yu9k1, d2yu9l1 automatically matched to d1i3qf_ protein/DNA complex; protein/RNA complex; complexed with mg, utp, zn |
PDB Entry: 2yu9 (more details), 3.4 Å
SCOPe Domain Sequences for d2yu9f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yu9f1 a.143.1.2 (F:72-155) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip lvirrylpdgsfedwsveelivdl
Timeline for d2yu9f1: