Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.27: Ribosomal protein S16 [54564] (1 superfamily) beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234 |
Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) |
Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein) |
Protein Ribosomal protein S16 [54567] (3 species) |
Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries) Uniprot P80379 |
Domain d2uxcp1: 2uxc P:1-83 [140019] Other proteins in same PDB: d2uxcb1, d2uxcc1, d2uxcc2, d2uxcd1, d2uxce1, d2uxce2, d2uxcf1, d2uxcg1, d2uxch1, d2uxci1, d2uxcj1, d2uxck1, d2uxcl1, d2uxcm1, d2uxcn1, d2uxco1, d2uxcq1, d2uxcr1, d2uxcs1, d2uxct1, d2uxcu1 automatically matched to d1emwa_ complexed with k, mg, par, zn |
PDB Entry: 2uxc (more details), 2.9 Å
SCOP Domain Sequences for d2uxcp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxcp1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]} mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl svgaqptdtarrllrqagvfrqe
Timeline for d2uxcp1: