![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) ![]() fold elaborated with additional structures |
![]() | Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
![]() | Protein Ribosomal protein S2 [52315] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries) Uniprot P80371 |
![]() | Domain d2uubb1: 2uub B:7-240 [139932] Other proteins in same PDB: d2uubc1, d2uubc2, d2uubd1, d2uube1, d2uube2, d2uubf1, d2uubg1, d2uubh1, d2uubj1, d2uubk1, d2uubl1, d2uubm1, d2uubn1, d2uubo1, d2uubp1, d2uubq1, d2uubr1, d2uubs1, d2uubt1, d2uubu1 automatically matched to d1i94b_ protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uub (more details), 2.8 Å
SCOPe Domain Sequences for d2uubb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uubb1 c.23.15.1 (B:7-240) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]} vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
Timeline for d2uubb1: