![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) ![]() |
![]() | Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) |
![]() | Protein Ribosomal protein S6 [54997] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries) Uniprot P23370 |
![]() | Domain d2ow8g1: 2ow8 g:1-101 [139404] Other proteins in same PDB: d2ow8c1, d2ow8d1, d2ow8d2, d2ow8e1, d2ow8f1, d2ow8f2, d2ow8h1, d2ow8i1, d2ow8j1, d2ow8k1, d2ow8l1, d2ow8m1, d2ow8n1, d2ow8o1, d2ow8p1, d2ow8q1, d2ow8r1, d2ow8s1, d2ow8t1, d2ow8u1, d2ow8v1 protein/RNA complex protein/RNA complex |
PDB Entry: 2ow8 (more details), 3.71 Å
SCOPe Domain Sequences for d2ow8g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ow8g1 d.58.14.1 (g:1-101) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]} mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
Timeline for d2ow8g1: