SCOPe 2.08: Domain d2otlw1: 2otl W:1-154

Lineage for d2otlw1 (2otl W:1-154)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
   core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold

4. Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family)

5. Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)

6. Protein Archaeal L30 (L30a) [55133] (1 species)
   long-chain member of the family; contains additional C-terminal (sub)domain

7. Species Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries)
   Uniprot P14121

8. Domain d2otlw1: 2otl W:1-154 [139368]
   Other proteins in same PDB: d2otl11, d2otl21, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlg1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlx1, d2otly1, d2otlz1
   automatically matched to d1ffkt_
   complexed with cd, cl, gir, k, mg, na
   has additional subdomain(s) that are not in the common domain

Details for d2otlw1

PDB Entry: 2otl, 2.7 Å

PDB Description: girodazole bound to the large subunit of haloarcula marismortui

PDB Compounds: (W:) 50S ribosomal protein L30P

SCOPe Domain Sequences for d2otlw1:

Sequence; same for both SEQRES and ATOM records:

>d2otlw1 d.59.1.1 (W:1-154) Archaeal L30 (L30a) {Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

Timeline for d2otlw1:

• d2otlw1 first appeared in SCOP 1.73
  
• d2otlw1 appears in SCOPe 2.07