Lineage for d2otjr1 (2otj R:1-150)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2948717Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 2948718Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 2948719Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 2948720Protein Ribosomal protein L22 [54845] (5 species)
  7. 2948758Species Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries)
    Uniprot P10970
  8. 2948804Domain d2otjr1: 2otj R:1-150 [139334]
    Other proteins in same PDB: d2otj11, d2otj21, d2otj31, d2otja1, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjg1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjw1, d2otjx1, d2otjy1, d2otjz1
    automatically matched to d1ffko_
    complexed with 13t, cd, cl, k, mg, na

Details for d2otjr1

PDB Entry: 2otj (more details), 2.9 Å

PDB Description: 13-deoxytedanolide bound to the large subunit of haloarcula marismortui
PDB Compounds: (R:) 50S ribosomal protein L22P

SCOPe Domain Sequences for d2otjr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otjr1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

SCOPe Domain Coordinates for d2otjr1:

Click to download the PDB-style file with coordinates for d2otjr1.
(The format of our PDB-style files is described here.)

Timeline for d2otjr1: