Lineage for d2os9b2 (2os9 B:205-234)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1708127Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1708128Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) (S)
  5. 1708129Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)
  6. 1708201Protein Surfactant protein [57949] (2 species)
  7. 1708202Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (24 PDB entries)
  8. 1708213Domain d2os9b2: 2os9 B:205-234 [139293]
    Other proteins in same PDB: d2os9a1, d2os9b1, d2os9c1
    complexed with ca, ins

Details for d2os9b2

PDB Entry: 2os9 (more details), 1.7 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein D in complex with myoinositol
PDB Compounds: (B:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d2os9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2os9b2 h.1.1.1 (B:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelf

SCOPe Domain Coordinates for d2os9b2:

Click to download the PDB-style file with coordinates for d2os9b2.
(The format of our PDB-style files is described here.)

Timeline for d2os9b2: