Lineage for d2oqee2 (2oqe E:18-115)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 855401Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 855402Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 855403Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 855587Species Yeast (Hansenula polymorpha) [TaxId:4905] [54422] (4 PDB entries)
  8. 855596Domain d2oqee2: 2oqe E:18-115 [139235]
    Other proteins in same PDB: d2oqea1, d2oqeb1, d2oqec1, d2oqed1, d2oqee1, d2oqef1
    automatically matched to d1ekma2
    complexed with cu, gol, sme, xe

Details for d2oqee2

PDB Entry: 2oqe (more details), 1.6 Å

PDB Description: crystal structure of hansenula polymorpha amine oxidase in complex with xe to 1.6 angstroms
PDB Compounds: (E:) Peroxisomal copper amine oxidase

SCOP Domain Sequences for d2oqee2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oqee2 d.17.2.1 (E:18-115) Copper amine oxidase, domains 1 and 2 {Yeast (Hansenula polymorpha) [TaxId: 4905]}
parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
layyvileagkpgvkeglvdlaslsvietraletvqpi

SCOP Domain Coordinates for d2oqee2:

Click to download the PDB-style file with coordinates for d2oqee2.
(The format of our PDB-style files is described here.)

Timeline for d2oqee2: