Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) |
Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
Species Yeast (Hansenula polymorpha) [TaxId:4905] [54422] (4 PDB entries) |
Domain d2oqee2: 2oqe E:18-115 [139235] Other proteins in same PDB: d2oqea1, d2oqeb1, d2oqec1, d2oqed1, d2oqee1, d2oqef1 automatically matched to d1ekma2 complexed with cu, gol, sme, xe |
PDB Entry: 2oqe (more details), 1.6 Å
SCOP Domain Sequences for d2oqee2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oqee2 d.17.2.1 (E:18-115) Copper amine oxidase, domains 1 and 2 {Yeast (Hansenula polymorpha) [TaxId: 4905]} parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr layyvileagkpgvkeglvdlaslsvietraletvqpi
Timeline for d2oqee2: