![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.12: ABC transporter ATPase domain-like [52686] (20 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
![]() | Protein Putative multidrug export ATP-binding/permease protein SAV1866 [142303] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [142304] (2 PDB entries) |
![]() | Domain d2onja1: 2onj A:324-578 [139154] Other proteins in same PDB: d2onja2, d2onjb2 automatically matched to 2HYD A:324-578 complexed with anp, na |
PDB Entry: 2onj (more details), 3.4 Å
SCOP Domain Sequences for d2onja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2onja1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} ikngvgaqpieikqgrididhvsfqyndneapilkdinlsiekgetvafvgmsgggkstl inliprfydvtsgqilidghnikdfltgslrnqiglvqqdnilfsdtvkenillgrptat deevveaakmanahdfimnlpqgydtevgergvklsggqkqrlsiariflnnppililde atsaldlesesiiqealdvlskdrttlivahrlstithadkivvienghivetgthreli akqgayehlysiqnl
Timeline for d2onja1: