SCOPe 2.07: Domain d2omyb2: 2omy B:2-100

Lineage for d2omyb2 (2omy B:2-100)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.1: Cadherin [49314] (4 proteins)

6. Protein E-cadherin (epithelial) [49317] (2 species)
   synonym: uvomorulin

7. Species Human (Homo sapiens) [TaxId:9606] [81981] (12 PDB entries)

8. Domain d2omyb2: 2omy B:2-100 [139153]
   Other proteins in same PDB: d2omya1, d2omya2, d2omya3, d2omyb3, d2omyb4
   automated match to d1o6sb_
   complexed with ca, cl

Details for d2omyb2

PDB Entry: 2omy, 1.7 Å

PDB Description: crystal structure of inla s192n/hec1 complex

PDB Compounds: (B:) epithelial-cadherin

SCOPe Domain Sequences for d2omyb2:

Sequence; same for both SEQRES and ATOM records:

>d2omyb2 b.1.6.1 (B:2-100) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
wvippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgwlk
vtepldreriatytlfshavssngnavedpmeilitvtd

Timeline for d2omyb2:

• d2omyb2 first appeared in SCOP 1.73, called d2omyb1
  
• d2omyb2 appears in SCOPe 2.06
  
• d2omyb2 appears in the current release, SCOPe 2.08